Skip to main content
ViralZone logo emblem ViralZone

Polyprotein Cleavage Prediction

( Last updated 27/July/2026 ) The polyprotein cleavage data provided here are intended to facilitate the analysis and comparison of viral polyprotein chains at the level of individual mature products. For each family, cleavage sites and their resulting mature peptides are annotated to support cross-species comparison, functional annotation, and structural studies.

Virus families infecting humans that encode polyproteins:

Kitrinoviricota

  • Hepeviridae (Coming soon)
  • Matonaviridae (Coming soon)
  • Orthoflaviviridae View
  • Togaviridae View

Pisuviricota

  • Caliciviridae View
  • Coronaviridae (Coming soon)
  • Picornaviridae View
  • Tobaniviridae (Coming soon)
  • Astroviridae (Coming soon)

Negarnaviricota

  • Nairoviridae (Coming soon)
  • Peribunyaviridae (Coming soon)

Artverviricota

  • Retroviridae (Coming soon)


The dataset contains FASTA sequences corresponding to cleavage products derived from reference viral polyproteins selected from the ICTV Virus Metadata Resource (VMR). Cleavage sites were predicted by sequence similarity between viruses belonging to the same genus or displaying high sequence similarity. Experimentally validated cleavage information recorded in UniProtKB/Swiss-Prot was used as the reference for these predictions.

FASTA headers follow the format: 

<UniProt AC>_<Chain ID>; <INSDC_AC>; <ICTV virus name>; <Acronym>; <TaxID>; <Cleavage range>; <Cleavage product name> [Subfamily=<Genus name>]* [Genus=<Genus name>]
Example:
>A0A0C4W3V9_001; KJ469371; Jutiapa virus; JUTV; 64299; 1-93; Capsid protein C [genus=Orthoflavivirus]
MLNNSKLKKPSGGGQRASGRRKKPSSQPVPMNLVMGVVHYATHIALGMKVNSRLRKFWRATPVGKLARVLTTLMNILRSLLNSVSQRKAKKQR
*(facultative)

On each virus family page, the complete dataset or selected subsets can be downloaded using the search filters. The download includes both FASTA and CSV files containing the filtered results.

Funded by NIH* through the Pathogen Data Network image

*This resource is supported as a whole or in part by the National Institute Of Allergy And Infectious Diseases of the National Institutes of Health under Grant n U24AI183840, awarded to the SIB Swiss Institute of Bioinformatics.